prot_L-elsbetiae_contig800.16987.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig800.16987.1 vs. uniprot
Match: A0A6H5KU10_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KU10_9PHAE) HSP 1 Score: 100 bits (249), Expect = 9.100e-23 Identity = 46/75 (61.33%), Postives = 55/75 (73.33%), Query Frame = 0 Query: 15 LDTSPNGAIRVSRGNKISLVQRLAECDGPLACHAIQKCLHQYVCVCAAAISRGDVSLKGELEEWYLSVLDTIMDC 89 L+ N + R +KIS VQRL CDGPLACHAIQ+CL +Y+ VCA AISRGDVS KGELEEW ++L+T M C Sbjct: 45 LERDSNDVVSAPRNSKISFVQRLTLCDGPLACHAIQRCLQRYIYVCAEAISRGDVSRKGELEEWLAAILETTMFC 119 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig800.16987.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig800.16987.1 ID=prot_L-elsbetiae_contig800.16987.1|Name=mRNA_L-elsbetiae_contig800.16987.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=89bpback to top |