prot_L-elsbetiae_contig80.16983.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig80.16983.1 vs. uniprot
Match: D8LM99_ECTSI (Hypothetical leucine rich repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM99_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 3.740e-10 Identity = 37/61 (60.66%), Postives = 42/61 (68.85%), Query Frame = 0 Query: 74 GENGFCEGSDWLLKVLSLEDMATVATPRGTRATGGGVGDAASALTHGSQVSIAGNPAFGLR 134 GE EGSDWLLK LSL++M AT ++ G DAAS LTHGS+VS AGNPAFGLR Sbjct: 521 GERDLFEGSDWLLKELSLQNMRISATSISKQSMSEGRKDAASVLTHGSEVSFAGNPAFGLR 581
BLAST of mRNA_L-elsbetiae_contig80.16983.1 vs. uniprot
Match: A0A6H5JTQ1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTQ1_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 6.940e-10 Identity = 36/61 (59.02%), Postives = 41/61 (67.21%), Query Frame = 0 Query: 74 GENGFCEGSDWLLKVLSLEDMATVATPRGTRATGGGVGDAASALTHGSQVSIAGNPAFGLR 134 GE EG+DWLLK LSL+DM AT ++ G D AS LTHGS+VS AGNPAFGLR Sbjct: 524 GERDMFEGNDWLLKELSLQDMRISATSINKQSMSEGRTDTASVLTHGSEVSFAGNPAFGLR 584 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig80.16983.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig80.16983.1 ID=prot_L-elsbetiae_contig80.16983.1|Name=mRNA_L-elsbetiae_contig80.16983.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=134bpback to top |