prot_L-elsbetiae_contig7810.16761.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7810.16761.1 vs. uniprot
Match: A0A6H5L2U1_9PHAE (BTB domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5L2U1_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 4.840e-10 Identity = 38/71 (53.52%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 58 LRTALFQRRHRECVRILVVIACFAFCRRGRAAIR----KVASPFSFLLWCLGLDRWRHRSAANSLLRGNNN 124 +R AL +R +C+RILV++AC A CRRGRAA+ KV SP SFLL C+GL R R R+ +LL GN N Sbjct: 11 VRLALQRRNGSDCLRILVMLACLACCRRGRAALSLTVCKVTSPVSFLLCCIGLSRRRDRNNG-TLLCGNGN 80 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7810.16761.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7810.16761.1 ID=prot_L-elsbetiae_contig7810.16761.1|Name=mRNA_L-elsbetiae_contig7810.16761.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=125bpback to top |