prot_L-elsbetiae_contig7391.16269.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7391.16269.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 1.580e-5 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 3 SKCHHVGCTKHPGYGASGSKTAEFCSEHKKEGMVNVRNR 41 S+C H CTK P YG +GSK EFCS+H ++GMVNV N+ Sbjct: 2 SQCGHANCTKRPTYGVAGSKKREFCSQHARDGMVNVNNK 40
BLAST of mRNA_L-elsbetiae_contig7391.16269.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 3.850e-5 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 3 SKCHHVGCTKHPGYGASGSKTAEFCSEHKKEGMVNVRNR 41 S+C H CTK P YG +GSK EFCS+H ++GMVNV N+ Sbjct: 62 SQCGHENCTKRPTYGVAGSKKREFCSQHARDGMVNVNNK 100 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7391.16269.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7391.16269.1 ID=prot_L-elsbetiae_contig7391.16269.1|Name=mRNA_L-elsbetiae_contig7391.16269.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=608bpback to top |