prot_L-elsbetiae_contig735.16222.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig735.16222.1 vs. uniprot
Match: A0A6H5KC88_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KC88_9PHAE) HSP 1 Score: 65.9 bits (159), Expect = 1.700e-7 Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 458 RKCAKEGCKRRPTFGAEGTRQAQFCASHKPEGFVNVLCKR 497 R C EGCKRRP FGA+GTR+ QFC+ HKP GFVNV +R Sbjct: 430 RTCGMEGCKRRPLFGAQGTRRPQFCSGHKPAGFVNVASRR 469
BLAST of mRNA_L-elsbetiae_contig735.16222.1 vs. uniprot
Match: D7G3Q3_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3Q3_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 2.300e-7 Identity = 44/59 (74.58%), Postives = 48/59 (81.36%), Query Frame = 0 Query: 458 RKCAKEGCKRRPTFGAEGTRQAQFCASHKPEGFVNVLCKRXXXXXXXXXXXXXXXGAKP 516 R C EGCKRRP FGAEGTR+ FC+ HKP GFVNV +RXXXXXXXXXXXXXX G+KP Sbjct: 455 RTCGMEGCKRRPLFGAEGTRRPLFCSGHKPAGFVNVASRRXXXXXXXXXXXXXXPGSKP 513 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig735.16222.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig735.16222.1 ID=prot_L-elsbetiae_contig735.16222.1|Name=mRNA_L-elsbetiae_contig735.16222.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=651bpback to top |