prot_L-elsbetiae_contig7304.16173.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7304.16173.1 vs. uniprot
Match: D8LEH6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEH6_ECTSI) HSP 1 Score: 92.4 bits (228), Expect = 6.210e-20 Identity = 46/58 (79.31%), Postives = 47/58 (81.03%), Query Frame = 0 Query: 33 ELRPFFRDSRLETTLALIRSGQAFCQERRIVADFVRRAKPTAAGSGKAEVQPTDDLLR 90 E R FFRD RLE TLALIRSGQAFCQER IV DFVRRAKPT G GKAE+QP DDL R Sbjct: 268 ERRNFFRDPRLEATLALIRSGQAFCQERHIVVDFVRRAKPTTVGLGKAELQPMDDLTR 325
BLAST of mRNA_L-elsbetiae_contig7304.16173.1 vs. uniprot
Match: A0A6H5JCY2_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCY2_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 1.220e-11 Identity = 37/56 (66.07%), Postives = 38/56 (67.86%), Query Frame = 0 Query: 35 RPFFRDSRLETTLALIRSGQAFCQERRIVADFVRRAKPTAAGSGKAEVQPTDDLLR 90 R FFRD RLE TLA FCQER IV DFVRRAKPT SGKAE+QP DD R Sbjct: 559 RNFFRDPRLEATLA-------FCQERHIVVDFVRRAKPTTVASGKAELQPMDDHTR 607 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7304.16173.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig7304.16173.1 ID=prot_L-elsbetiae_contig7304.16173.1|Name=mRNA_L-elsbetiae_contig7304.16173.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=91bpback to top |