prot_L-elsbetiae_contig6610.15335.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Match: A0A6H5KVY1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVY1_9PHAE) HSP 1 Score: 99.4 bits (246), Expect = 5.170e-23 Identity = 46/53 (86.79%), Postives = 48/53 (90.57%), Query Frame = 0 Query: 1 ALASVGEWEALRKFGSERKSPIGYKPFALACMRTKQTGLYGADAERYITSYID 53 ALASVGEWEALRKFG+ERKSPIGYKPFALACMR KQTGL G D ERYIT YI+ Sbjct: 739 ALASVGEWEALRKFGAERKSPIGYKPFALACMRKKQTGLLGDDTERYITGYIE 791
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Match: D7FS70_ECTSI (Vacuolar protein sorting vps16 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS70_ECTSI) HSP 1 Score: 97.1 bits (240), Expect = 3.250e-22 Identity = 45/53 (84.91%), Postives = 47/53 (88.68%), Query Frame = 0 Query: 1 ALASVGEWEALRKFGSERKSPIGYKPFALACMRTKQTGLYGADAERYITSYID 53 ALASVGEWEALRKFG+ERKSPIGYKPFALACMR K TGL G D ERYIT YI+ Sbjct: 474 ALASVGEWEALRKFGAERKSPIGYKPFALACMRKKPTGLLGDDTERYITGYIE 526
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Match: W7U1V8_9STRA (Vacuolar protein sorting-associated protein 16 n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7U1V8_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 1.790e-6 Identity = 22/36 (61.11%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 1 ALASVGEWEALRKFGSERKSPIGYKPFALACMRTKQ 36 ALA+ G++E L+ F SE+KSP+GYKPFA AC++ KQ Sbjct: 936 ALAASGQFENLKAFASEKKSPVGYKPFAQACIKHKQ 971
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Match: A0A836CCV0_9STRA (Vps16, N-terminal region-domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CCV0_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 4.580e-6 Identity = 27/48 (56.25%), Postives = 32/48 (66.67%), Query Frame = 0 Query: 1 ALASVGEWEALRKFGSERKSPIGYKPFALACMRTKQTGLYGADAERYI 48 ALAS G+W ALR +ER+SPIGY PFA A + Q G A+AE YI Sbjct: 1165 ALASSGQWAALRLLAAERRSPIGYAPFARAAL---QHGQPTAEAEHYI 1209
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Match: A0A7S2CBJ2_9STRA (Hypothetical protein n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2CBJ2_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 6.720e-6 Identity = 21/35 (60.00%), Postives = 26/35 (74.29%), Query Frame = 0 Query: 1 ALASVGEWEALRKFGSERKSPIGYKPFALACMRTK 35 ALA +WE L+KFG E+KSPIGY PFA AC+ + Sbjct: 86 ALAKSQQWEELKKFGGEKKSPIGYGPFAEACIEQR 120
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Match: A0A812UTB3_SYMMI (VCL1 protein n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A812UTB3_SYMMI) HSP 1 Score: 49.3 bits (116), Expect = 2.170e-5 Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 0 Query: 2 LASVGEWEALRKFGSERKSPIGYKPFALACMR 33 + G+WE L K +E+KSPIGYKPFALAC + Sbjct: 385 FSKTGQWELLSKLATEKKSPIGYKPFALACKK 416
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Match: A0A7S4MSF4_9EUKA (Hypothetical protein n=1 Tax=Vannella sp. CB-2014 TaxID=1487602 RepID=A0A7S4MSF4_9EUKA) HSP 1 Score: 48.5 bits (114), Expect = 4.110e-5 Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 0 Query: 1 ALASVGEWEALRKFGSERKSPIGYKPFALACMRTKQTGLYGADAERYITSYID 53 ALASV +WEAL F E+KSP+GY PFA C+ + +A +YI D Sbjct: 728 ALASVPKWEALFNFSKEKKSPVGYAPFAEVCLEKDEI----EEAIKYIPRITD 776 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6610.15335.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6610.15335.1 ID=prot_L-elsbetiae_contig6610.15335.1|Name=mRNA_L-elsbetiae_contig6610.15335.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=53bpback to top |