prot_L-elsbetiae_contig6599.15308.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6599.15308.1 vs. uniprot
Match: D8LCP8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCP8_ECTSI) HSP 1 Score: 79.7 bits (195), Expect = 3.850e-16 Identity = 34/52 (65.38%), Postives = 39/52 (75.00%), Query Frame = 0 Query: 2 GIVTDPEPTEDEALPRGVSMTWGEACDIETFLLEITTHHANGNISLVKSVPC 53 G+V DPEP EA PRGVSMTWGE CD+ETF L+++ H GN S VKSVPC Sbjct: 221 GVVIDPEPDAGEAFPRGVSMTWGEVCDVETFSLKVSKHTVEGNTSAVKSVPC 272
BLAST of mRNA_L-elsbetiae_contig6599.15308.1 vs. uniprot
Match: A0A6H5JF50_9PHAE (LNR domain-containing protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JF50_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 5.220e-10 Identity = 27/53 (50.94%), Postives = 41/53 (77.36%), Query Frame = 0 Query: 1 MGIVTDPEPTEDEALPRGVSMTWGEACDIETFLLEITTHHANGNISLVKSVPC 53 +G V DPEP+ + ++PR VSMTW + CDIETFLL++ + +++G+ S+ SVPC Sbjct: 225 LGEVVDPEPSTN-SIPRTVSMTWTDPCDIETFLLKLVSRNSDGSTSIATSVPC 276
BLAST of mRNA_L-elsbetiae_contig6599.15308.1 vs. uniprot
Match: A0A6H5JG69_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JG69_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 8.820e-7 Identity = 22/29 (75.86%), Postives = 23/29 (79.31%), Query Frame = 0 Query: 2 GIVTDPEPTEDEALPRGVSMTWGEACDIE 30 G+V DP P DEA PRGVSMTWGE CDIE Sbjct: 251 GVVIDPAPDADEAFPRGVSMTWGEVCDIE 279 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6599.15308.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6599.15308.1 ID=prot_L-elsbetiae_contig6599.15308.1|Name=mRNA_L-elsbetiae_contig6599.15308.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=53bpback to top |