prot_L-elsbetiae_contig6598.15306.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6598.15306.1 vs. uniprot
Match: D7FH66_ECTSI (RNA-binding S4 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH66_ECTSI) HSP 1 Score: 69.3 bits (168), Expect = 6.570e-13 Identity = 40/46 (86.96%), Postives = 43/46 (93.48%), Query Frame = 0 Query: 42 VSTVEASLLLVSVASAGMDMSRSKISAAVKSGLVLVNWKAATSGTT 87 VSTVEASL L SVASAGM MSRSK+SAA+KSGLVLVNWKAA+SGTT Sbjct: 76 VSTVEASLRLDSVASAGMGMSRSKMSAAIKSGLVLVNWKAASSGTT 121
BLAST of mRNA_L-elsbetiae_contig6598.15306.1 vs. uniprot
Match: A0A6H5J7Q1_9PHAE (S4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7Q1_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 1.450e-11 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 0 Query: 42 VSTVEASLLLVSVASAGMDMSRSKISAAVKSGLVLVNWKAATSGTT 87 VSTVEASL L SVASAGM MSRSK+SAA+KSGLVLVNWKAA SGTT Sbjct: 245 VSTVEASLRLDSVASAGMGMSRSKMSAAIKSGLVLVNWKAAGSGTT 290
BLAST of mRNA_L-elsbetiae_contig6598.15306.1 vs. uniprot
Match: A0A836CE46_9STRA (S4 domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CE46_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 3.910e-5 Identity = 28/47 (59.57%), Postives = 38/47 (80.85%), Query Frame = 0 Query: 38 PHVK--VSTVEASLLLVSVASAGMDMSRSKISAAVKSGLVLVNWKAA 82 P +K V++VEASL L ++ASAGM MSRSK++ A+KSG+V VNW+ A Sbjct: 183 PPIKKHVTSVEASLRLDAIASAGMGMSRSKMADAIKSGMVFVNWREA 229
BLAST of mRNA_L-elsbetiae_contig6598.15306.1 vs. uniprot
Match: A0A1X6PFP3_PORUM (S4 domain-containing protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6PFP3_PORUM) HSP 1 Score: 50.1 bits (118), Expect = 4.340e-5 Identity = 30/48 (62.50%), Postives = 40/48 (83.33%), Query Frame = 0 Query: 38 PHVK-VSTVEASLLLVSVASAGMDMSRSKISAAVKSGLVLVNWKAATS 84 P VK ++TVEAS+ L +VASAG +SRSK++AAVKSG VL+NW+ A+S Sbjct: 263 PTVKELTTVEASMRLDAVASAGFGVSRSKMAAAVKSGDVLINWREASS 310 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6598.15306.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6598.15306.1 ID=prot_L-elsbetiae_contig6598.15306.1|Name=mRNA_L-elsbetiae_contig6598.15306.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=87bpback to top |