prot_L-elsbetiae_contig6592.15297.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6592.15297.1 vs. uniprot
Match: D7FN22_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FN22_ECTSI) HSP 1 Score: 76.6 bits (187), Expect = 1.440e-14 Identity = 38/42 (90.48%), Postives = 40/42 (95.24%), Query Frame = 0 Query: 36 LGPRAVTREDLTRLDDEIANLSKTVEQVAMAHTRQVLRNVAD 77 LGPRAVTREDLTRLD+EIANLSKTVEQ AMA TRQ+LRNVAD Sbjct: 793 LGPRAVTREDLTRLDNEIANLSKTVEQAAMAQTRQILRNVAD 834
BLAST of mRNA_L-elsbetiae_contig6592.15297.1 vs. uniprot
Match: A0A6H5L3T3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L3T3_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 1.440e-6 Identity = 26/28 (92.86%), Postives = 28/28 (100.00%), Query Frame = 0 Query: 36 LGPRAVTREDLTRLDDEIANLSKTVEQV 63 LGPRAVTREDLTRLD+EIANLSKTVEQ+ Sbjct: 738 LGPRAVTREDLTRLDNEIANLSKTVEQL 765 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6592.15297.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6592.15297.1 ID=prot_L-elsbetiae_contig6592.15297.1|Name=mRNA_L-elsbetiae_contig6592.15297.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=78bpback to top |