prot_L-elsbetiae_contig6565.15267.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6565.15267.1 vs. uniprot
Match: A0A6H5JKE3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKE3_9PHAE) HSP 1 Score: 130 bits (327), Expect = 4.030e-36 Identity = 65/94 (69.15%), Postives = 75/94 (79.79%), Query Frame = 0 Query: 1 MSEPVEVSVTKAVRKMDVSTGDNKSSLEVTEVSVSFPGMPGAYPRDWVTFCAEGSVESIEAFLGGAGKPLVRLLSLREALQVGYPQFVQMISTE 94 MS P+EV+V K+VRK V+T + K+S EVTEVSVSFP MP YP++W TFC EG + SIEAFLG GKPLV LLSLR ALQVGYP FVQMIST+ Sbjct: 119 MSTPLEVTVKKSVRKTTVTTREGKASFEVTEVSVSFPEMPETYPKNWTTFCVEGKMTSIEAFLGSKGKPLVALLSLRGALQVGYPHFVQMISTQ 212 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6565.15267.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6565.15267.1 ID=prot_L-elsbetiae_contig6565.15267.1|Name=mRNA_L-elsbetiae_contig6565.15267.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=95bpback to top |