prot_L-elsbetiae_contig6562.15263.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6562.15263.1 vs. uniprot
Match: D8LTU0_ECTSI (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTU0_ECTSI) HSP 1 Score: 73.2 bits (178), Expect = 2.400e-11 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 0 Query: 191 MQVVP-HYLSLMGSRRTSAEDFLSLLQDSEELQAREVPAMPEEMRDDN 237 MQVVP HYLSLMGSRRTSAEDFLSLLQDSEELQAREVP+M +E +D+ Sbjct: 18 MQVVPQHYLSLMGSRRTSAEDFLSLLQDSEELQAREVPSMQDEEPEDS 65
BLAST of mRNA_L-elsbetiae_contig6562.15263.1 vs. uniprot
Match: A0A6H5K231_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K231_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 2.320e-8 Identity = 66/195 (33.85%), Postives = 76/195 (38.97%), Query Frame = 0 Query: 44 AGNAAFGFDQDGGPVPRVQSLNSLPLNASMSGSLSVQDLAMLLGMNGGXXXXXXXXXXXXXXXSAQLPGNIPTPADLGGIMGMGGMRSTPSSAFLRSSFGQLTDLQVESMHQLQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAMQVVP-HYLSLMGSRRTSAEDFLSLLQDSEELQAREVPAMPEEMRDDN 237 AGNAAFGFDQDGGPVPR Q+LNSLP N SM+GSLSVQ G S+ + F + VVP H+LSLMG+RRTSAEDFLSLLQ AREVP+M +E DD+ Sbjct: 412 AGNAAFGFDQDGGPVPRAQTLNSLPSN-SMTGSLSVQ-----------------------------------------------GRISSRAMVF----------------------------------------------------RLPVVPQHFLSLMGARRTSAEDFLSLLQ------AREVPSMQDEESDDS 500 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6562.15263.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6562.15263.1 ID=prot_L-elsbetiae_contig6562.15263.1|Name=mRNA_L-elsbetiae_contig6562.15263.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=456bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|