prot_L-elsbetiae_contig6099.14637.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6099.14637.1 vs. uniprot
Match: A0A6H5LCV9_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LCV9_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 1.510e-10 Identity = 37/62 (59.68%), Postives = 49/62 (79.03%), Query Frame = 0 Query: 45 KRQGGELVDTSNSSSDFSGPQRVRVSNSIIPPDLSLSFW--PPATPDSKTS--RLKSKTVSR 102 KRQG E+ D SNSS DF+GPQRVR++++ +P D+SLSFW P +TPDSK+ RL SKTV++ Sbjct: 94 KRQGEEIADVSNSSGDFTGPQRVRINSNSVPADISLSFWSLPASTPDSKSGGGRLTSKTVTK 155 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6099.14637.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig6099.14637.1 ID=prot_L-elsbetiae_contig6099.14637.1|Name=mRNA_L-elsbetiae_contig6099.14637.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=198bpback to top |