prot_L-elsbetiae_contig570.14084.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig570.14084.1 vs. uniprot
Match: A0A6H5K5X6_9PHAE (EF-hand domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5X6_9PHAE) HSP 1 Score: 77.0 bits (188), Expect = 1.070e-11 Identity = 35/58 (60.34%), Postives = 43/58 (74.14%), Query Frame = 0 Query: 294 PFEFDSVVRVLGVEDPEVQGKLLTVIGFEAAADGGPGTVVLQRRGRVVKAPASKVYRL 351 PF FDSVVRVLGV+DP GKL+TV+GFE GG G VVLQR+ +VV+ PA V+ + Sbjct: 690 PFAFDSVVRVLGVDDPRTDGKLMTVVGFEPCPKGGEGIVVLQRKRKVVRVPAENVFNV 747
BLAST of mRNA_L-elsbetiae_contig570.14084.1 vs. uniprot
Match: D7G0S5_ECTSI (Calcium dependent protein kinase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0S5_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 2.540e-11 Identity = 35/58 (60.34%), Postives = 43/58 (74.14%), Query Frame = 0 Query: 294 PFEFDSVVRVLGVEDPEVQGKLLTVIGFEAAADGGPGTVVLQRRGRVVKAPASKVYRL 351 PF FDSVVRVLGV+DP GKL+TVIGFE GG G VVLQR+ +VV+ P + V+ + Sbjct: 685 PFAFDSVVRVLGVDDPRTDGKLMTVIGFEPCPRGGAGIVVLQRKRKVVRVPTANVFNV 742 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig570.14084.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig570.14084.1 ID=prot_L-elsbetiae_contig570.14084.1|Name=mRNA_L-elsbetiae_contig570.14084.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=354bpback to top |