prot_L-elsbetiae_contig52.13291.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig52.13291.1 vs. uniprot
Match: A0A482SJN7_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SJN7_9ARCH) HSP 1 Score: 69.3 bits (168), Expect = 7.170e-11 Identity = 36/125 (28.80%), Postives = 67/125 (53.60%), Query Frame = 0 Query: 5 LANKYTGGKLSLGILDEMMTLATGALKRAVYGIMPNEERQHHGYLLEKAPSKEPTPE--ELYLAGTITLKAYEETRFPEAKLAQEKRDAHYPTPEEPQPCVVC-RKVTATIACMECPNKVCQPCV 126 L+ + GK+S+ +++++ + ++Y +P +E+ +H YL EK ++P + +L ITLK YE+ RFPE K ++ + YP E C++C + + + C C N VC+ C+ Sbjct: 194 LSEYFLQGKISVDDIEQILLCSPDVWSNSLYNYLPEDEQVYHQYLNEKIVHEDPNKSIAKKFLDEEITLKEYEDLRFPERKAKADRDNMFYPLLFEGTDCIICGEEKSGVVKCHTCDNMVCKACI 318 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig52.13291.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig52.13291.1 ID=prot_L-elsbetiae_contig52.13291.1|Name=mRNA_L-elsbetiae_contig52.13291.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=153bpback to top |