prot_L-elsbetiae_contig4795.12662.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig4795.12662.1 vs. uniprot
Match: D8LUB9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LUB9_ECTSI) HSP 1 Score: 83.6 bits (205), Expect = 2.680e-16 Identity = 49/115 (42.61%), Postives = 63/115 (54.78%), Query Frame = 0 Query: 1 MSADGGKP-----------PPPRVGAFMPEEFCDEVYDNVDDAVADEMENLECRLRKTAPQPGATDQ---------------ASMKTCCDRVQKHAQKWFDRNTDIFDRYVKKNM 89 MSA+GG+P P P +G F E FCDEVYD +DD++A+ M +E L + A + DQ AS+KTCCD VQ Q+ FDRN DI DRY+KKN+ Sbjct: 1 MSAEGGEPXXXXXXXXXXXPHPLLGDFKTENFCDEVYDYMDDSLAEAMVKMEEELIQAAAKVKGADQGXXXXXXXXXXXDIEASIKTCCDNVQTRIQQEFDRNIDILDRYIKKNV 115 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig4795.12662.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig4795.12662.1 ID=prot_L-elsbetiae_contig4795.12662.1|Name=mRNA_L-elsbetiae_contig4795.12662.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=150bpback to top |