prot_L-elsbetiae_contig4778.12624.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig4778.12624.1 vs. uniprot
Match: D7FUJ6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUJ6_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 1.480e-5 Identity = 26/39 (66.67%), Postives = 27/39 (69.23%), Query Frame = 0 Query: 1 MVDVASKACAHPGCTKQPSYGKAGSKP-EYCRGHAKDGM 38 MVDV SK C HPGCTK+PSYG GSK E C HA GM Sbjct: 1 MVDVVSKRCGHPGCTKRPSYGNDGSKKAELCAQHALQGM 39
BLAST of mRNA_L-elsbetiae_contig4778.12624.1 vs. uniprot
Match: D7FSL7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSL7_ECTSI) HSP 1 Score: 53.9 bits (128), Expect = 5.810e-5 Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 1 MVDVASKACAHPGCTKQPSYGKAGSK-PEYCRGHAKDGM 38 M++V SK C HPGCTK+PS+G GSK PE+C HAK M Sbjct: 1 MINVYSKRCGHPGCTKRPSFGTTGSKRPEFCSQHAKQDM 39 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig4778.12624.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig4778.12624.1 ID=prot_L-elsbetiae_contig4778.12624.1|Name=mRNA_L-elsbetiae_contig4778.12624.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=272bpback to top |