prot_L-elsbetiae_contig4777.12622.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig4777.12622.1 vs. uniprot
Match: D7G8G2_ECTSI (BHLH domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8G2_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 7.000e-6 Identity = 29/58 (50.00%), Postives = 36/58 (62.07%), Query Frame = 0 Query: 239 PFSQDHLGSLLRGGXXXXXXXXDALNDNDGYTD-AALNASGLGLWGWCFPSPTPMIGA 295 PF LG+L+ N+GY D AAL+A+GLGLWGWCFPSPTP++GA Sbjct: 2 PFPSHQLGALMAASGGDCGNS----GTNNGYRDVAALDATGLGLWGWCFPSPTPIMGA 55
BLAST of mRNA_L-elsbetiae_contig4777.12622.1 vs. uniprot
Match: A0A6H5JG03_9PHAE (BHLH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JG03_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 1.810e-5 Identity = 28/58 (48.28%), Postives = 36/58 (62.07%), Query Frame = 0 Query: 239 PFSQDHLGSLLRGGXXXXXXXXDALNDNDGYTD-AALNASGLGLWGWCFPSPTPMIGA 295 PF LG+L+ N+GY D AA++A+GLGLWGWCFPSPTP++GA Sbjct: 2 PFPSHQLGALMAASGGDSGGS----GTNNGYPDVAAMDATGLGLWGWCFPSPTPIMGA 55 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig4777.12622.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig4777.12622.1 ID=prot_L-elsbetiae_contig4777.12622.1|Name=mRNA_L-elsbetiae_contig4777.12622.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=295bpback to top |