prot_L-elsbetiae_contig4766.12604.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig4766.12604.1 vs. uniprot
Match: D7FK76_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK76_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 9.430e-10 Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 0 Query: 84 VIRGECWAALPGSRLVLSELLGGLVSEATQCSSFVCESILKETNTRISRMHQIHIHRRN 142 V+ +CW PG+R + +LL LV + QC++ V ESIL+ET R++RM QIHIHRRN Sbjct: 5 VVGSDCWTLRPGARTAMHDLLVTLVGNSVQCATMVAESILQETAKRVTRMTQIHIHRRN 63
BLAST of mRNA_L-elsbetiae_contig4766.12604.1 vs. uniprot
Match: A0A6H5KCR7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCR7_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 1.490e-9 Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = 0 Query: 84 VIRGECWAALPGSRLVLSELLGGLVSEATQCSSFVCESILKETNTRISRMHQIHIHRRN 142 VI +CW PG+R + +LL LV + QC++ V ESIL+ET R++RM QIHIHRRN Sbjct: 5 VIGSDCWTLRPGARTAMHDLLVTLVGNSVQCATMVAESILQETAKRVTRMTQIHIHRRN 63 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig4766.12604.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig4766.12604.1 ID=prot_L-elsbetiae_contig4766.12604.1|Name=mRNA_L-elsbetiae_contig4766.12604.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=142bpback to top |