prot_L-elsbetiae_contig2130.6514.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2130.6514.1 vs. uniprot
Match: D7FUJ6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUJ6_ECTSI) HSP 1 Score: 54.3 bits (129), Expect = 1.240e-6 Identity = 26/40 (65.00%), Postives = 29/40 (72.50%), Query Frame = 0 Query: 1 MVNVVSKKCTHHGCTKYPSYGNAGGR-AEYCRDHAEDGMV 39 MV+VVSK+C H GCTK PSYGN G + AE C HA GMV Sbjct: 1 MVDVVSKRCGHPGCTKRPSYGNDGSKKAELCAQHALQGMV 40
BLAST of mRNA_L-elsbetiae_contig2130.6514.1 vs. uniprot
Match: D8LNJ8_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNJ8_ECTSI) HSP 1 Score: 51.6 bits (122), Expect = 8.000e-5 Identity = 22/40 (55.00%), Postives = 29/40 (72.50%), Query Frame = 0 Query: 1 MVNVVSKKCTHHGCTKYPSYGNAGGR-AEYCRDHAEDGMV 39 M++VVSK+C H GC K+PSYG + AE+C +HA GMV Sbjct: 1 MIDVVSKRCAHSGCNKWPSYGMPPSKKAEFCANHARPGMV 40 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2130.6514.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2130.6514.1 ID=prot_L-elsbetiae_contig2130.6514.1|Name=mRNA_L-elsbetiae_contig2130.6514.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=149bpback to top |