prot_L-elsbetiae_contig2123.6477.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2123.6477.1 vs. uniprot
Match: D7FUJ6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUJ6_ECTSI) HSP 1 Score: 69.3 bits (168), Expect = 3.150e-11 Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = 0 Query: 1 MVDVVSKRCGHQGCNKRPVYGVEGTKKAELCSQHARKGM 39 MVDVVSKRCGH GC KRP YG +G+KKAELC+QHA +GM Sbjct: 1 MVDVVSKRCGHPGCTKRPSYGNDGSKKAELCAQHALQGM 39
BLAST of mRNA_L-elsbetiae_contig2123.6477.1 vs. uniprot
Match: D8LNJ8_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNJ8_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 2.390e-7 Identity = 26/39 (66.67%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 1 MVDVVSKRCGHQGCNKRPVYGVEGTKKAELCSQHARKGM 39 M+DVVSKRC H GCNK P YG+ +KKAE C+ HAR GM Sbjct: 1 MIDVVSKRCAHSGCNKWPSYGMPPSKKAEFCANHARPGM 39 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2123.6477.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2123.6477.1 ID=prot_L-elsbetiae_contig2123.6477.1|Name=mRNA_L-elsbetiae_contig2123.6477.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=285bpback to top |