prot_L-elsbetiae_contig2112.6426.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig2112.6426.1 vs. uniprot
Match: A0A6H5JG92_9PHAE (BRCT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JG92_9PHAE) HSP 1 Score: 88.6 bits (218), Expect = 2.590e-16 Identity = 45/84 (53.57%), Postives = 56/84 (66.67%), Query Frame = 0 Query: 137 LSPGRWTYEAMVPFVRSEGWKCADGEGFHTWFLVSQAAE--GGRKTVDYLVTEEEVVDFVRRDR----HVLARYEAYCQGAVRA 214 L P R Y AM+PF+RSEGWKCADG+GFHTWF V A E G+K VDYLV+EEEVV +V R++ V + C+ +RA Sbjct: 148 LDPARLEYPAMIPFLRSEGWKCADGKGFHTWFFVVPAKETHDGKKRVDYLVSEEEVVRYVLRNKGAELRVRRKVPHVCEVTLRA 231
BLAST of mRNA_L-elsbetiae_contig2112.6426.1 vs. uniprot
Match: D7FW83_ECTSI (BRCT domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FW83_ECTSI) HSP 1 Score: 79.3 bits (194), Expect = 3.860e-13 Identity = 39/80 (48.75%), Postives = 53/80 (66.25%), Query Frame = 0 Query: 138 SPGRWTYEAMVPFVRSEGWKCADGEGFHTWFLVSQAAEG--GRKTVDYLVTEEEVVDFVRRDRHVLARYEAYCQGAVRAA 215 SP TY+AM+ F+ EGWKC G+G HTWF + +G GR +D+LV+EEEVV VR D+ L+RYEA+ + +AA Sbjct: 772 SPEWLTYKAMISFLDVEGWKCVLGKGLHTWFYLLPGKKGRNGRYGLDFLVSEEEVVQHVRCDQPALSRYEAFLKAEAKAA 851 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig2112.6426.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig2112.6426.1 ID=prot_L-elsbetiae_contig2112.6426.1|Name=mRNA_L-elsbetiae_contig2112.6426.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=251bpback to top |