prot_L-elsbetiae_contig19371.5740.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19371.5740.1 vs. uniprot
Match: D7FK36_ECTSI (Protein kinase domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FK36_ECTSI) HSP 1 Score: 84.7 bits (208), Expect = 2.750e-17 Identity = 50/83 (60.24%), Postives = 62/83 (74.70%), Query Frame = 0 Query: 4 RGDEQHHGSEEQSSRRFSRSYRLGKKMGEGEFANTYGATKRGEKRGERSSCIVKRA-RRGSSKDGEHALAEEARILRLLTHRS 85 RG EQ+ G E+ S FSR Y LGKK+GEG FA T+GA +RG+++G + SCIVKRA +RG+S + H L EEARILRLLTH S Sbjct: 498 RGTEQNRG-EQPGSSEFSRLYALGKKLGEGAFAETFGAIRRGQRKGSQGSCIVKRAVQRGASHEVMHGLVEEARILRLLTHPS 579
BLAST of mRNA_L-elsbetiae_contig19371.5740.1 vs. uniprot
Match: D8LK21_ECTSI (Possible Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LK21_ECTSI) HSP 1 Score: 68.2 bits (165), Expect = 1.640e-11 Identity = 38/81 (46.91%), Postives = 52/81 (64.20%), Query Frame = 0 Query: 3 VRGDEQHHGSEEQSSRRFSRSYRLGKKMGEGEFANTYGATKRGEKRGERSSCIVKRARRGSSKDGEHALAEEARILRLLTH 83 + G + H E S+RFSRS+ LGKK+GEG FA + AT +G++ G +S + + RRG +K+ E L EE RILRLL H Sbjct: 59 LSGGDGKHSFREFHSKRFSRSFNLGKKLGEGAFAEVFEATVKGDRPGGKSYAVKRTVRRGLAKEDEKGLLEEVRILRLLQH 139 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19371.5740.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19371.5740.1 ID=prot_L-elsbetiae_contig19371.5740.1|Name=mRNA_L-elsbetiae_contig19371.5740.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=85bpback to top |