prot_L-elsbetiae_contig17974.5140.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17974.5140.1 vs. uniprot
Match: A0A6H5JXC7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JXC7_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 6.260e-10 Identity = 27/55 (49.09%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 54 TYKTFRNQACFDAARALNVRGAGVQVRRNKCFEKACHALWPGSDAIGESIAAGFS 108 T K RN+AC+DA ALN RG GVQ+RR KCF AC A+WP + ++ S Sbjct: 124 TTKRMRNKACYDAGTALNARGRGVQLRRQKCFTHACRAVWPDDQPLPAAVLDALS 178 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17974.5140.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig17974.5140.1 ID=prot_L-elsbetiae_contig17974.5140.1|Name=mRNA_L-elsbetiae_contig17974.5140.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=116bpback to top |