prot_L-elsbetiae_contig1757.4950.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1757.4950.1 vs. uniprot
Match: A0A6H5KA62_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KA62_9PHAE) HSP 1 Score: 110 bits (274), Expect = 1.370e-26 Identity = 56/77 (72.73%), Postives = 63/77 (81.82%), Query Frame = 0 Query: 1 SNLLAVLEVYRGRRRLFQIQVDEIAQEKRARHYQKDDTILGLCVEHTGESDVGFRNIAHVERLATKLKTDDIHLGSE 77 +NL AV+EVY GR RLFQ QVDEIAQEK ARHYQ +DTILGLC + TGES+V F+NI HVERL KLK +IHLGSE Sbjct: 130 ANLQAVVEVYGGRSRLFQSQVDEIAQEKHARHYQNNDTILGLCAQCTGESNVYFKNINHVERLGGKLKKGEIHLGSE 206 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1757.4950.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1757.4950.1 ID=prot_L-elsbetiae_contig1757.4950.1|Name=mRNA_L-elsbetiae_contig1757.4950.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=90bpback to top |