prot_L-elsbetiae_contig1749.4916.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1749.4916.1 vs. uniprot
Match: D8LEK8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEK8_ECTSI) HSP 1 Score: 71.2 bits (173), Expect = 1.490e-12 Identity = 29/52 (55.77%), Postives = 45/52 (86.54%), Query Frame = 0 Query: 2 VRRWINSGSLGLLTAIIVFYVSVGVPIRRLVFDPLESPDPRVAEALARRKEG 53 V RW+N+ +G ++A ++F++S+G+PIR+LVFDPLES DPRV+ ALA+R++G Sbjct: 269 VARWVNTRIMGFISATVIFFLSLGLPIRQLVFDPLESSDPRVSRALAKRRQG 320
BLAST of mRNA_L-elsbetiae_contig1749.4916.1 vs. uniprot
Match: D8LEL1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEL1_ECTSI) HSP 1 Score: 52.0 bits (123), Expect = 3.120e-6 Identity = 22/48 (45.83%), Postives = 35/48 (72.92%), Query Frame = 0 Query: 5 WINSGSLGLLTAIIVFYVSVGVPIRRLVFDPLESPDPRVAEALARRKE 52 WI + +++ ++F +S+G P R+L F+PLES DP V++ALARRK+ Sbjct: 43 WITERYIAFISSCVMFSLSLGAPARQLFFNPLESSDPEVSDALARRKD 90 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1749.4916.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1749.4916.1 ID=prot_L-elsbetiae_contig1749.4916.1|Name=mRNA_L-elsbetiae_contig1749.4916.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=87bpback to top |