prot_L-elsbetiae_contig1742.4891.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1742.4891.1 vs. uniprot
Match: D7G4Q4_ECTSI (Mtg2, mitochondrial Obg/CtgA-like GTPase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4Q4_ECTSI) HSP 1 Score: 87.4 bits (215), Expect = 4.480e-18 Identity = 55/95 (57.89%), Postives = 64/95 (67.37%), Query Frame = 0 Query: 4 SRCLTRRPLGLSRPSTFRVANANCN-GIG-VQVLNRGAGGVPGKRRKYRGDFKFVDKLRIVASGGKGGDGCISLEGEHIEMCAPDRDRDPPSGCS 96 SRC R LG+ R + C+ G+ V VLNR AGG PGKRR +RGD+KFVDKLRI+ASGGKGGDGCISLEG++ P R R PSG S Sbjct: 7 SRC---RVLGVLRVCHLGFGSPGCHAGVSSVLVLNRQAGGRPGKRRNHRGDYKFVDKLRILASGGKGGDGCISLEGDN-----PTRKR--PSGGS 91 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1742.4891.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1742.4891.1 ID=prot_L-elsbetiae_contig1742.4891.1|Name=mRNA_L-elsbetiae_contig1742.4891.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=97bpback to top |