prot_L-elsbetiae_contig16529.4425.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A6H5KDM4_9PHAE (RNase_PH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDM4_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 2.680e-15 Identity = 35/38 (92.11%), Postives = 36/38 (94.74%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFEV 38 EVT+DGSKV VHHTDDKEP PLALHHVPICVTFAIFEV Sbjct: 166 EVTVDGSKVVVHHTDDKEPHPLALHHVPICVTFAIFEV 203
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A8B8D2D4_CRAVI (Exosome complex component RRP45 n=1 Tax=Crassostrea virginica TaxID=6565 RepID=A0A8B8D2D4_CRAVI) HSP 1 Score: 58.9 bits (141), Expect = 4.640e-9 Identity = 22/37 (59.46%), Postives = 34/37 (91.89%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+DGS+V VH +D+K+P+PL++HH+PICVTF+ +E Sbjct: 164 DVTVDGSEVIVHPSDEKDPIPLSVHHMPICVTFSFYE 200
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: UPI00148A43C3 (exosome complex component RRP45 isoform X1 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI00148A43C3) HSP 1 Score: 58.9 bits (141), Expect = 4.640e-9 Identity = 22/37 (59.46%), Postives = 34/37 (91.89%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+DGS+V VH +D+K+P+PL++HH+PICVTF+ +E Sbjct: 164 DVTVDGSEVIVHPSDEKDPIPLSVHHMPICVTFSFYE 200
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A8B8D643_CRAVI (Exosome complex component RRP45 n=7 Tax=Crassostrea virginica TaxID=6565 RepID=A0A8B8D643_CRAVI) HSP 1 Score: 58.9 bits (141), Expect = 4.650e-9 Identity = 22/37 (59.46%), Postives = 34/37 (91.89%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+DGS+V VH +D+K+P+PL++HH+PICVTF+ +E Sbjct: 164 DVTVDGSEVIVHPSDEKDPIPLSVHHMPICVTFSFYE 200
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: UPI00148AC116 (exosome complex component RRP45 isoform X2 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI00148AC116) HSP 1 Score: 58.9 bits (141), Expect = 4.650e-9 Identity = 22/37 (59.46%), Postives = 34/37 (91.89%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+DGS+V VH +D+K+P+PL++HH+PICVTF+ +E Sbjct: 164 DVTVDGSEVIVHPSDEKDPIPLSVHHMPICVTFSFYE 200
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A1S3JT43_LINUN (Exosome complex component RRP45 n=2 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3JT43_LINUN) HSP 1 Score: 58.5 bits (140), Expect = 6.360e-9 Identity = 21/37 (56.76%), Postives = 32/37 (86.49%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+DG +V +H +++EP+PL+LHH+PICVTFA +E Sbjct: 164 DVTVDGEEVTIHKAEEREPIPLSLHHMPICVTFAFYE 200
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A835ZEC1_9STRA (Ribosomal protein S5 domain 2-type protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZEC1_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 5.680e-8 Identity = 23/38 (60.53%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 EVTIDGSK-VEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+ G VEVHH+D++E PLALHHVP+C+TFA+F+ Sbjct: 170 DVTVSGEGFVEVHHSDEREAQPLALHHVPLCITFALFD 207
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A210QR03_MIZYE (Exosome complex component RRP45 n=3 Tax=Pectinidae TaxID=6566 RepID=A0A210QR03_MIZYE) HSP 1 Score: 55.1 bits (131), Expect = 1.060e-7 Identity = 20/37 (54.05%), Postives = 32/37 (86.49%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+DGS V VH ++K+P+PL++HH+PICV+F+ +E Sbjct: 119 DVTVDGSNVIVHPVEEKDPIPLSVHHMPICVSFSFYE 155
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A812D0V0_SEPPH (Exosome complex component RRP45 n=1 Tax=Sepia pharaonis TaxID=158019 RepID=A0A812D0V0_SEPPH) HSP 1 Score: 54.7 bits (130), Expect = 1.450e-7 Identity = 20/37 (54.05%), Postives = 30/37 (81.08%), Query Frame = 0 Query: 1 EVTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +VT+ +V VH D+KEP+PL+LHH+P+CV+FA F+ Sbjct: 164 DVTVSAEEVTVHPVDEKEPIPLSLHHMPVCVSFAFFQ 200
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Match: A0A7S1I9Y2_9EUGL (Hypothetical protein (Fragment) n=1 Tax=Eutreptiella gymnastica TaxID=73025 RepID=A0A7S1I9Y2_9EUGL) HSP 1 Score: 54.7 bits (130), Expect = 1.450e-7 Identity = 19/36 (52.78%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 2 VTIDGSKVEVHHTDDKEPLPLALHHVPICVTFAIFE 37 +TIDG +V VH ++ +EP+PL++HHVP+CVT+ +F+ Sbjct: 164 ITIDGDRVIVHSSEAREPVPLSIHHVPVCVTYGLFD 199 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16529.4425.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig16529.4425.1 ID=prot_L-elsbetiae_contig16529.4425.1|Name=mRNA_L-elsbetiae_contig16529.4425.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=39bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|