prot_L-elsbetiae_contig1640.4351.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1640.4351.1 vs. uniprot
Match: D8LFX6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LFX6_ECTSI) HSP 1 Score: 57.4 bits (137), Expect = 4.370e-6 Identity = 27/53 (50.94%), Postives = 32/53 (60.38%), Query Frame = 0 Query: 1 MVNVKSKKCTHHGGCTKVPSYGNAGGKK-EYCRDHAKDEMVDVKSKRCTXHGC 52 M+NV+ + C H GGC PSY AG KK E+C HA VDV S+RC GC Sbjct: 36 MINVRDRTCCHPGGCPTRPSYAEAGSKKPEFCVLHAPKGTVDVLSRRCARKGC 88 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1640.4351.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1640.4351.1 ID=prot_L-elsbetiae_contig1640.4351.1|Name=mRNA_L-elsbetiae_contig1640.4351.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=252bpback to top |