prot_L-elsbetiae_contig15205.3716.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15205.3716.1 vs. uniprot
Match: A0A6H5JT94_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT94_9PHAE) HSP 1 Score: 122 bits (307), Expect = 2.990e-31 Identity = 57/106 (53.77%), Postives = 72/106 (67.92%), Query Frame = 0 Query: 1 MKCGKGGCNATANPADTMPITCSNKSTPHQHYRYDMIPTFFTVVPANSTHDCRPKTRDDVPVPSSTSTLTPALEEMLLCDAEECIHLDIEHQKMRSGYILDVKYVA 106 MKCG GCNATANP D +P TCSNK+ + H YDM+ T FTV+P NS H C P + D +P+PS+ S T LE+ LCD EE ++LD + QK RSG+ + KYVA Sbjct: 88 MKCGHNGCNATANPTDALPTTCSNKTDRYVHNTYDMVRTLFTVIPMNSVHGCGPISPDGLPIPSTMSINTKVLEDAFLCDGEEYVNLDSDEQKNRSGWFIGTKYVA 193 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15205.3716.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15205.3716.1 ID=prot_L-elsbetiae_contig15205.3716.1|Name=mRNA_L-elsbetiae_contig15205.3716.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=129bpback to top |