prot_L-elsbetiae_contig1515.3684.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1515.3684.1 vs. uniprot
Match: D8LU64_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LU64_ECTSI) HSP 1 Score: 66.2 bits (160), Expect = 6.300e-10 Identity = 43/91 (47.25%), Postives = 48/91 (52.75%), Query Frame = 0 Query: 208 SSLARLMRQGGAGKREAPGFDAAVTASANEGKGXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDNSS---DGGAAHEDLSAWLHSTDDWWTS 295 +S +RLM+QGG +EAPGFDAAV ASA G DD+ DGGAAHEDLSAWLHST DWWTS Sbjct: 54 ASFSRLMQQGGG--KEAPGFDAAVRASAASSDGNTGGVEVAAVADAVDAG-----------DDDKXXXXDGGAAHEDLSAWLHSTHDWWTS 131
BLAST of mRNA_L-elsbetiae_contig1515.3684.1 vs. uniprot
Match: A0A6H5KGC1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KGC1_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 4.430e-6 Identity = 51/82 (62.20%), Postives = 55/82 (67.07%), Query Frame = 0 Query: 214 MRQGGAGKREAPGFDAAVTASANEGKGXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDNSSDGGAAHEDLSAWLHSTDDWWTS 295 M++GG ++APGFDAAV ASA G XXXXXXXXX XXXXXXX D GAAHEDLSAWLHST DWWTS Sbjct: 1 MQEGGG--KKAPGFDAAVRASAASSDGNARXXXXXXXXXPDAIDVGDXXXXXXX------DEGAAHEDLSAWLHSTHDWWTS 74 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1515.3684.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1515.3684.1 ID=prot_L-elsbetiae_contig1515.3684.1|Name=mRNA_L-elsbetiae_contig1515.3684.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=296bpback to top |