prot_L-elsbetiae_contig15133.3675.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Match: A0A7S3NLJ5_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NLJ5_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 7.830e-7 Identity = 23/43 (53.49%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 12 DEAEPLCRRALEISEQIYGPNHPKIATCLNNLATQVQARGEFE 54 DEA+PL RA+EI E++Y PNHP +AT LNNLA ++ +G+++ Sbjct: 1 DEAKPLYERAIEIYEKVYDPNHPHVATGLNNLAGLLEEQGKYD 43
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Match: A0A7S3NLG6_9STRA (Hypothetical protein (Fragment) n=2 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3NLG6_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 1.420e-6 Identity = 23/43 (53.49%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 12 DEAEPLCRRALEISEQIYGPNHPKIATCLNNLATQVQARGEFE 54 DEA+PL RA+EI E++Y PNHP +AT LNNLA ++ +G+++ Sbjct: 1 DEAKPLYERAIEIYEKVYDPNHPHVATGLNNLAGLLEEQGKYD 43
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Match: A7C642_9GAMM (TPR repeat protein n=1 Tax=Beggiatoa sp. PS TaxID=422289 RepID=A7C642_9GAMM) HSP 1 Score: 53.9 bits (128), Expect = 8.720e-6 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 4 VYGTNRRDDEAEPLCRRALEISEQIYGPNHPKIATCLNNLA 44 ++ T D+A+PL RAL I E++YGPNHP++AT LNNLA Sbjct: 4 LHRTQGEYDQAKPLYERALAIDEKVYGPNHPEVATDLNNLA 44
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Match: UPI0013D29528 (tetratricopeptide repeat protein n=1 Tax=Desulfobacter hydrogenophilus TaxID=2291 RepID=UPI0013D29528) HSP 1 Score: 51.2 bits (121), Expect = 1.220e-5 Identity = 22/40 (55.00%), Postives = 30/40 (75.00%), Query Frame = 0 Query: 5 YGTNRRDDEAEPLCRRALEISEQIYGPNHPKIATCLNNLA 44 Y + + +EAEPL +RAL+I E + GP+HP +AT LNNLA Sbjct: 1 YESQGKYEEAEPLYQRALKIRETVLGPDHPSVATTLNNLA 40
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Match: D7G180_ECTSI (TPR repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G180_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 2.910e-5 Identity = 22/35 (62.86%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 10 RDDEAEPLCRRALEISEQIYGPNHPKIATCLNNLA 44 + +EAEPL RR+L I E++YGP+HP++AT LNNLA Sbjct: 83 KHEEAEPLYRRSLAIDEEVYGPDHPEVATDLNNLA 117
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Match: A0A8L7TK25_BRUMA (TPR_REGION domain-containing protein n=2 Tax=Brugia malayi TaxID=6279 RepID=A0A8L7TK25_BRUMA) HSP 1 Score: 52.4 bits (124), Expect = 8.130e-5 Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 0 Query: 3 LVYGTNRRDDEAEPLCRRALEISEQIYGPNHPKIATCLNNLA 44 ++YG + +AEPLC+RALEI E + G +HP +A LNNLA Sbjct: 282 MLYGKRGKYKDAEPLCKRALEIRENVLGADHPDVAKQLNNLA 323
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Match: UPI001EE4A569 (tetratricopeptide repeat protein n=1 Tax=Frankia sp. CN4 TaxID=1836974 RepID=UPI001EE4A569) HSP 1 Score: 49.3 bits (116), Expect = 9.780e-5 Identity = 22/35 (62.86%), Postives = 27/35 (77.14%), Query Frame = 0 Query: 10 RDDEAEPLCRRALEISEQIYGPNHPKIATCLNNLA 44 R EA PL RRAL I E +YGP+HP++A+ LNNLA Sbjct: 6 RGAEALPLARRALAIDETVYGPDHPEVASRLNNLA 40 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15133.3675.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15133.3675.1 ID=prot_L-elsbetiae_contig15133.3675.1|Name=mRNA_L-elsbetiae_contig15133.3675.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=177bpback to top |