prot_L-elsbetiae_contig15131.3673.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig15131.3673.1 vs. uniprot
Match: D8LJI6_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJI6_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 2.600e-8 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 0 Query: 130 HPSFGYTSDMKARRCARHRLENMEGVKGHQRQK 162 HPSFGY SD KARRCARHRLENMEGVKGH++++ Sbjct: 625 HPSFGYASDKKARRCARHRLENMEGVKGHRQKR 657
BLAST of mRNA_L-elsbetiae_contig15131.3673.1 vs. uniprot
Match: A0A6H5JGG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGG2_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 2.900e-5 Identity = 18/39 (46.15%), Postives = 31/39 (79.49%), Query Frame = 0 Query: 9 CNDDQCTRQPSFGTEGDRRASYCAEHKKAGMINVLARRC 47 C +D CT +PS+G G ++A +C++HKK GM+N++++RC Sbjct: 27 CQEDGCTTRPSYGNAGCKKAEFCSQHKKPGMMNLVSKRC 65 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig15131.3673.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig15131.3673.1 ID=prot_L-elsbetiae_contig15131.3673.1|Name=mRNA_L-elsbetiae_contig15131.3673.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=200bpback to top |