prot_L-elsbetiae_contig13699.2815.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13699.2815.1 vs. uniprot
Match: A0A6H5JAK8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAK8_9PHAE) HSP 1 Score: 102 bits (255), Expect = 1.290e-22 Identity = 50/70 (71.43%), Postives = 57/70 (81.43%), Query Frame = 0 Query: 93 LTWQPTPFSTTDFVAK-IPERPSEVAFRSTSVGGKGDSVIVLPEPRYEAAVALFKRRGDFPQTTNGVEDP 161 + WQPTPFS TDFVAK I RP EVAFRSTSVGGKGD+VIV+P RY+AA+ LF RR + P TT+GVEDP Sbjct: 1 MQWQPTPFSATDFVAKNISGRPDEVAFRSTSVGGKGDTVIVIPTSRYKAALDLFSRRHELPATTDGVEDP 70
BLAST of mRNA_L-elsbetiae_contig13699.2815.1 vs. uniprot
Match: A0A6H5LDF4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LDF4_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 6.220e-17 Identity = 43/64 (67.19%), Postives = 51/64 (79.69%), Query Frame = 0 Query: 99 PFSTTDFVAK-IPERPSEVAFRSTSVGGKGDSVIVLPEPRYEAAVALFKRRGDFPQTTNGVEDP 161 PFS ++FVAK I RP EVAFRSTSVGG G +VIV+P RYEAA+ L+ RR +FP TT+GVEDP Sbjct: 8 PFSASNFVAKNISGRPGEVAFRSTSVGGNGGTVIVIPTSRYEAALDLYSRRHEFPATTDGVEDP 71 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13699.2815.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13699.2815.1 ID=prot_L-elsbetiae_contig13699.2815.1|Name=mRNA_L-elsbetiae_contig13699.2815.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=161bpback to top |