prot_L-elsbetiae_contig13688.2799.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13688.2799.1 vs. uniprot
Match: A0A6H5LBZ3_9PHAE (Myosin motor domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LBZ3_9PHAE) HSP 1 Score: 95.5 bits (236), Expect = 1.270e-21 Identity = 47/55 (85.45%), Postives = 50/55 (90.91%), Query Frame = 0 Query: 1 MEVGANVWVKDKDGEEAWVAGVVLEKSAGKPVKVEIEVDEDFSEEPLTFTFNEDD 55 MEVGA VWVKDK+GEEAWVAG VLEKSAGKP KVEIEVDE+FSEEPLTFT E+D Sbjct: 1 MEVGAAVWVKDKEGEEAWVAGTVLEKSAGKPCKVEIEVDEEFSEEPLTFTLREED 55
BLAST of mRNA_L-elsbetiae_contig13688.2799.1 vs. uniprot
Match: D8LTS1_ECTSI (Myosin D n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTS1_ECTSI) HSP 1 Score: 95.5 bits (236), Expect = 1.270e-21 Identity = 47/55 (85.45%), Postives = 50/55 (90.91%), Query Frame = 0 Query: 1 MEVGANVWVKDKDGEEAWVAGVVLEKSAGKPVKVEIEVDEDFSEEPLTFTFNEDD 55 MEVGA VWVKDK+GEEAWVAG VLEKSAGKP KVEIEVDE+FSEEPLTFT E+D Sbjct: 1 MEVGAAVWVKDKEGEEAWVAGTVLEKSAGKPCKVEIEVDEEFSEEPLTFTLREED 55 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13688.2799.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13688.2799.1 ID=prot_L-elsbetiae_contig13688.2799.1|Name=mRNA_L-elsbetiae_contig13688.2799.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=55bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|