prot_L-elsbetiae_contig13443.2650.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13443.2650.1 vs. uniprot
Match: A0A6H5KQ23_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQ23_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 3.620e-17 Identity = 63/110 (57.27%), Postives = 73/110 (66.36%), Query Frame = 0 Query: 1 MFKRRSSKGDVSAKIGYDHVNGKAPSRNGSISSVGGGL----QSVAPVANIVAG----HQKQSSFS-SASSYRKTTGMPSPEGDSGGAPDTISNSNGTSPLAALKPLPPS 101 MF+RRSSK ++SAKIGYDHVNGKA S+N S+SS+ +VAPVA+I H KQ S S +SS RKTTGMPSPE DSG P SPLAALKPLPP+ Sbjct: 1 MFRRRSSK-ELSAKIGYDHVNGKA-SKNTSVSSMSSSTPAASNAVAPVASIPPPGGHLHHKQGSCSPGSSSSRKTTGMPSPEADSGVDPSATER---PSPLAALKPLPPA 105 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13443.2650.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig13443.2650.1 ID=prot_L-elsbetiae_contig13443.2650.1|Name=mRNA_L-elsbetiae_contig13443.2650.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=153bpback to top |