prot_L-elsbetiae_contig12795.2239.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12795.2239.1 vs. uniprot
Match: D8LDW6_ECTSI (Cupin-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDW6_ECTSI) HSP 1 Score: 92.0 bits (227), Expect = 2.380e-21 Identity = 45/59 (76.27%), Postives = 49/59 (83.05%), Query Frame = 0 Query: 2 TRFFELPSEAIQASLTSDDRALQALIESLPEAPAAARRQCLKMCGLDNGDDDLSYDYGY 60 TRFFELPSEAIQASL +D ALQ LIESLP+APAAARRQCL+ CGL +G D SY YGY Sbjct: 169 TRFFELPSEAIQASLNFEDPALQRLIESLPDAPAAARRQCLERCGLADGGDGFSYSYGY 227
BLAST of mRNA_L-elsbetiae_contig12795.2239.1 vs. uniprot
Match: A0A6H5JV79_9PHAE (Cupin type-1 domain-containing protein n=6 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JV79_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 3.140e-15 Identity = 38/62 (61.29%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 2 TRFFELPSEAIQASLTSDDRALQALIESLPEAPAAARRQCLKMCGLDNGDDDLSYDYGYDSD 63 TRFFELP EAIQAS+ ++ LQ LIESLP+APAAAR+QCL+ C + + SYDY YD D Sbjct: 168 TRFFELPLEAIQASVNFEEPVLQNLIESLPDAPAAARQQCLQRCRMAEPGNHFSYDYTYDVD 229 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12795.2239.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig12795.2239.1 ID=prot_L-elsbetiae_contig12795.2239.1|Name=mRNA_L-elsbetiae_contig12795.2239.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=72bpback to top |