prot_L-elsbetiae_contig11581.1377.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11581.1377.1 vs. uniprot
Match: A0A6H5K128_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K128_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 7.630e-8 Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 0 Query: 201 SSVLLRRLKALHERYGEFAEENGYVRCEDTE 231 SSVLLRRL+ALH+RYGEFAEENGYVRCEDTE Sbjct: 719 SSVLLRRLQALHKRYGEFAEENGYVRCEDTE 749
BLAST of mRNA_L-elsbetiae_contig11581.1377.1 vs. uniprot
Match: D7G3G9_ECTSI (Bifunctional Aldehyde Dehydrogenase/Phosphoglucomutase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3G9_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 7.690e-8 Identity = 30/42 (71.43%), Postives = 36/42 (85.71%), Query Frame = 0 Query: 190 SAAMEQGGRGRSSVLLRRLKALHERYGEFAEENGYVRCEDTE 231 SA ++ + SSVLLRR++ALH+RYGEFAEENGYVRCEDTE Sbjct: 741 SAGEQKSKKSVSSVLLRRVQALHKRYGEFAEENGYVRCEDTE 782 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11581.1377.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig11581.1377.1 ID=prot_L-elsbetiae_contig11581.1377.1|Name=mRNA_L-elsbetiae_contig11581.1377.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=236bpback to top |