prot_L-elsbetiae_contig1145.1269.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1145.1269.1 vs. uniprot
Match: A0A6H5K9E5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K9E5_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 7.240e-19 Identity = 50/73 (68.49%), Postives = 59/73 (80.82%), Query Frame = 0 Query: 9 ESGDEGS-PAMGELTRQHSGGSVQLA--EGELATEQATLLRDDLHLPALAASVVIDDFKFGFNLLMGSVACVA 78 + GD+GS P M +L+RQHSGGSV+L +GELATE+A LRD L LPALAASV I+DFKFGFN+LMGSVA A Sbjct: 678 DGGDDGSLPEMDQLSRQHSGGSVKLGGDDGELATEEALRLRDSLQLPALAASVAINDFKFGFNMLMGSVAAEA 750
BLAST of mRNA_L-elsbetiae_contig1145.1269.1 vs. uniprot
Match: D8LB75_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LB75_ECTSI) HSP 1 Score: 89.4 bits (220), Expect = 7.310e-19 Identity = 50/73 (68.49%), Postives = 59/73 (80.82%), Query Frame = 0 Query: 9 ESGDEGS-PAMGELTRQHSGGSVQLA--EGELATEQATLLRDDLHLPALAASVVIDDFKFGFNLLMGSVACVA 78 + GD+GS P M +L+RQHSGGSV+L +GELATE+A LRD L LPALAASV I+DFKFGFN+LMGSVA A Sbjct: 653 DGGDDGSLPEMDQLSRQHSGGSVKLGGDDGELATEEALRLRDSLQLPALAASVAINDFKFGFNMLMGSVAAEA 725 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1145.1269.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig1145.1269.1 ID=prot_L-elsbetiae_contig1145.1269.1|Name=mRNA_L-elsbetiae_contig1145.1269.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=87bpback to top |