prot_L-elsbetiae_contig11436.1254.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11436.1254.1 vs. uniprot
Match: D7FUF2_ECTSI (PHD-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FUF2_ECTSI) HSP 1 Score: 112 bits (281), Expect = 1.730e-26 Identity = 47/71 (66.20%), Postives = 54/71 (76.06%), Query Frame = 0 Query: 56 GVACRQCRRPRSGSTKSGGKTCGTCGGWWHKSASCAGVNGCPESGKWVGGWRCRWCLSTWEKGLKVRSDEV 126 G C +C++ RSGS KS GKTCGTCG WWH S C G GCPESG+WVGGWRCR CLS WEKGL+ R+ +V Sbjct: 363 GTVCFKCKKKRSGSNKSSGKTCGTCGRWWHNSVHCCGAYGCPESGEWVGGWRCRHCLSLWEKGLRDRAAKV 433 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11436.1254.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig11436.1254.1 ID=prot_L-elsbetiae_contig11436.1254.1|Name=mRNA_L-elsbetiae_contig11436.1254.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=126bpback to top |