prot_L-elsbetiae_contig111.989.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig111.989.1 vs. uniprot
Match: D7G587_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G587_ECTSI) HSP 1 Score: 70.1 bits (170), Expect = 4.790e-13 Identity = 33/48 (68.75%), Postives = 44/48 (91.67%), Query Frame = 0 Query: 1 WIGEQLGLLENVVREALTDVESRILESRLPVTVEVQEGGEEIAVPYQR 48 W +QL L+E++VR++LTD+ESRILESRLPVTVEV+E G+EIAVPY++ Sbjct: 235 WTNDQLLLVESMVRQSLTDIESRILESRLPVTVEVREDGDEIAVPYRK 282
BLAST of mRNA_L-elsbetiae_contig111.989.1 vs. uniprot
Match: A0A6H5KUK4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUK4_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 2.870e-12 Identity = 31/48 (64.58%), Postives = 44/48 (91.67%), Query Frame = 0 Query: 1 WIGEQLGLLENVVREALTDVESRILESRLPVTVEVQEGGEEIAVPYQR 48 W +QL L+E+++R++LTD+ESRILESRLPVTVEV+E G+E+AVPY++ Sbjct: 342 WTNDQLLLVESMLRQSLTDIESRILESRLPVTVEVREDGDEVAVPYRK 389 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig111.989.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig111.989.1 ID=prot_L-elsbetiae_contig111.989.1|Name=mRNA_L-elsbetiae_contig111.989.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=50bpback to top |