mRNA_L-elsbetiae_contig9529.18509.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9529.18509.1 vs. uniprot
Match: A0A6H5L5R1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5R1_9PHAE) HSP 1 Score: 109 bits (273), Expect = 7.810e-26 Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = 1 Query: 1 PHLIEVNCSPALGLDEPADREVKLPLISDLLDLVSVESACRANEASRAAKLSRARSLPGYSRPL 192 PHLIEVNCSPALGLDEPADREVKLPLISDLLDLV +ESAC A EA+RA ++S+ARS+P YSRPL Sbjct: 173 PHLIEVNCSPALGLDEPADREVKLPLISDLLDLVDIESACLAQEATRATRISKARSMPSYSRPL 236
BLAST of mRNA_L-elsbetiae_contig9529.18509.1 vs. uniprot
Match: A0A7S1CGP1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1CGP1_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.320e-6 Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1 Query: 1 PHLIEVNCSPALGLDEPADREVKLPLISDLLDLVSVESACRANEASRAAKLSRARSL 171 P LIEVNCSPALG+D D E+K PL+SD ++++S ++ RA A+RA K +R R L Sbjct: 218 PWLIEVNCSPALGIDCAVDEEIKYPLLSDTMEVLSHDAHRRAQAAARA-KATRRRGL 273
BLAST of mRNA_L-elsbetiae_contig9529.18509.1 vs. uniprot
Match: A0A7S2DXB0_9EUKA (Hypothetical protein n=1 Tax=Haptolina brevifila TaxID=156173 RepID=A0A7S2DXB0_9EUKA) HSP 1 Score: 53.9 bits (128), Expect = 7.300e-6 Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 1 Query: 1 PHLIEVNCSPALGLDEPADREVKLPLISDLLDLVSVE---SACRANEASRAAKLSRARSLPGYS 183 P L+EVNCSPALG++ ADREVK PLI+DL D+++ + + A A+ ++AR PG S Sbjct: 363 PWLLEVNCSPALGVECTADREVKEPLIADLCDILAFQRGGGGAASLPAGXXARAAKARGWPGAS 426 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9529.18509.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9529.18509.1 >prot_L-elsbetiae_contig9529.18509.1 ID=prot_L-elsbetiae_contig9529.18509.1|Name=mRNA_L-elsbetiae_contig9529.18509.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=125bp PHLIEVNCSPALGLDEPADREVKLPLISDLLDLVSVESACRANEASRAAKback to top mRNA from alignment at L-elsbetiae_contig9529:3138..4454+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9529.18509.1 ID=mRNA_L-elsbetiae_contig9529.18509.1|Name=mRNA_L-elsbetiae_contig9529.18509.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1317bp|location=Sequence derived from alignment at L-elsbetiae_contig9529:3138..4454+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9529:3138..4454+ >mRNA_L-elsbetiae_contig9529.18509.1 ID=mRNA_L-elsbetiae_contig9529.18509.1|Name=mRNA_L-elsbetiae_contig9529.18509.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=750bp|location=Sequence derived from alignment at L-elsbetiae_contig9529:3138..4454+ (Laminarionema elsbetiae ELsaHSoW15)back to top |