mRNA_L-elsbetiae_contig899.17988.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig899.17988.1 vs. uniprot
Match: D8LSU4_ECTSI (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSU4_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 3.270e-8 Identity = 33/53 (62.26%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 1 MAPLFQVLSRETAVLTTAASPSPLWVAAKTLVCEALFHEENLEGYREAFTAAE 159 M LFQ L E + TA++ SPL AAK + C+ALFHEE+LEGYREAFTAAE Sbjct: 356 MGSLFQALPPEGS---TASASSPLKTAAKAVACDALFHEEHLEGYREAFTAAE 405
BLAST of mRNA_L-elsbetiae_contig899.17988.1 vs. uniprot
Match: A0A6H5JIT9_9PHAE (Urb2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JIT9_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 1.150e-7 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 1 MAPLFQVLSRETAVLTTAASPSPLWVAAKTLVCEALFHEENLEGYREAFTAAEQ 162 M LF+ L E + TTA++ SPL AAK + +ALFHEE+LEGYREAFTAAE+ Sbjct: 404 MGSLFRALPPE--ISTTASASSPLKTAAKAVAFDALFHEEHLEGYREAFTAAEE 455 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig899.17988.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig899.17988.1 >prot_L-elsbetiae_contig899.17988.1 ID=prot_L-elsbetiae_contig899.17988.1|Name=mRNA_L-elsbetiae_contig899.17988.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=101bp MAPLFQVLSRETAVLTTAASPSPLWVAAKTLVCEALFHEENLEGYREAFTback to top mRNA from alignment at L-elsbetiae_contig899:13572..13874+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig899.17988.1 ID=mRNA_L-elsbetiae_contig899.17988.1|Name=mRNA_L-elsbetiae_contig899.17988.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=303bp|location=Sequence derived from alignment at L-elsbetiae_contig899:13572..13874+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig899:13572..13874+ >mRNA_L-elsbetiae_contig899.17988.1 ID=mRNA_L-elsbetiae_contig899.17988.1|Name=mRNA_L-elsbetiae_contig899.17988.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=606bp|location=Sequence derived from alignment at L-elsbetiae_contig899:13572..13874+ (Laminarionema elsbetiae ELsaHSoW15)back to top |