mRNA_L-elsbetiae_contig854.17572.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig854.17572.1 vs. uniprot
Match: A0A3C0TVI1_9PROT (3-mercaptopyruvate sulfurtransferase n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A3C0TVI1_9PROT) HSP 1 Score: 53.5 bits (127), Expect = 5.620e-6 Identity = 30/62 (48.39%), Postives = 37/62 (59.68%), Query Frame = 3 Query: 177 MPTPLLAAGWRAARH*R---RFSPAPWSLRKSGK---AEFKEGHLPGAVFFDIDEIADVSLP 344 +P L++ W AA R A W L SG+ AE+KEGH+PGAVFFDIDEI D + P Sbjct: 4 VPNTLVSTEWLAAHLNAPDIRIVDASWYLPGSGRDPRAEYKEGHIPGAVFFDIDEICDTANP 65
BLAST of mRNA_L-elsbetiae_contig854.17572.1 vs. uniprot
Match: A0A3M1JQA8_9PROT (Sulfurtransferase n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A3M1JQA8_9PROT) HSP 1 Score: 53.1 bits (126), Expect = 7.770e-6 Identity = 30/67 (44.78%), Postives = 38/67 (56.72%), Query Frame = 3 Query: 165 MPVMMPTPLLAAGWRAARH*R----RFSPAPWSLRKSGK---AEFKEGHLPGAVFFDIDEIADVSLP 344 MPV+ PL++ W A H R R A W + G+ AEF + H+PGAVFFDIDEI+D P Sbjct: 1 MPVVTADPLVSTQW-LAEHLRAPDVRVVDASWHMPAEGRDPRAEFAQAHIPGAVFFDIDEISDTDSP 66
BLAST of mRNA_L-elsbetiae_contig854.17572.1 vs. uniprot
Match: A0A8H9XF11_9CAUL (Sulfurtransferase n=1 Tax=Phenylobacterium sp. TaxID=1871053 RepID=A0A8H9XF11_9CAUL) HSP 1 Score: 52.8 bits (125), Expect = 1.060e-5 Identity = 29/59 (49.15%), Postives = 36/59 (61.02%), Query Frame = 3 Query: 174 MMPTPLLAAGWRAARH*R---RFSPAPWSL---RKSGKAEFKEGHLPGAVFFDIDEIAD 332 M+P PL+ W AAR R A W + + G EF++GH+PGAVFFDIDEIAD Sbjct: 1 MLPGPLVDVDWLAARLDDPDVRVVDATWHMPAENRPGLKEFRKGHIPGAVFFDIDEIAD 59
BLAST of mRNA_L-elsbetiae_contig854.17572.1 vs. uniprot
Match: A0A1Q7RZ19_9BACT (Sulfurtransferase n=4 Tax=unclassified Candidatus Rokubacteria TaxID=2760815 RepID=A0A1Q7RZ19_9BACT) HSP 1 Score: 51.2 bits (121), Expect = 4.050e-5 Identity = 28/58 (48.28%), Postives = 33/58 (56.90%), Query Frame = 3 Query: 189 LLAAGWRAA---RH*RRFSPAPWSLRKSGKA---EFKEGHLPGAVFFDIDEIADVSLP 344 L+ GW A R R W +R G+ EF E H+PGAVFFDIDEIAD+S P Sbjct: 6 LVTTGWLVANLGRRNLRVVDGSWHMRGLGREAFEEFVEAHVPGAVFFDIDEIADLSTP 63
BLAST of mRNA_L-elsbetiae_contig854.17572.1 vs. uniprot
Match: A0A2M8U0W2_9PROT (Sulfurtransferase n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2M8U0W2_9PROT) HSP 1 Score: 50.4 bits (119), Expect = 7.110e-5 Identity = 22/42 (52.38%), Postives = 29/42 (69.05%), Query Frame = 3 Query: 228 RFSPAPW---SLRKSGKAEFKEGHLPGAVFFDIDEIADVSLP 344 R A W ++ + GKAE+ H+PGAVFFDIDEIAD+ +P Sbjct: 26 RIVDASWYLPAMNRDGKAEYNAAHIPGAVFFDIDEIADLDVP 67 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig854.17572.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig854.17572.1 >prot_L-elsbetiae_contig854.17572.1 ID=prot_L-elsbetiae_contig854.17572.1|Name=mRNA_L-elsbetiae_contig854.17572.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=99bp MRGVTAFLLPLLLSLVQQYRLFNMSTAFLFRRPVLLSRPGKALLARTSNHback to top mRNA from alignment at L-elsbetiae_contig854:13572..14555+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig854.17572.1 ID=mRNA_L-elsbetiae_contig854.17572.1|Name=mRNA_L-elsbetiae_contig854.17572.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=984bp|location=Sequence derived from alignment at L-elsbetiae_contig854:13572..14555+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig854:13572..14555+ >mRNA_L-elsbetiae_contig854.17572.1 ID=mRNA_L-elsbetiae_contig854.17572.1|Name=mRNA_L-elsbetiae_contig854.17572.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=594bp|location=Sequence derived from alignment at L-elsbetiae_contig854:13572..14555+ (Laminarionema elsbetiae ELsaHSoW15)back to top |