mRNA_L-elsbetiae_contig8364.17364.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: D7G7F9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7F9_ECTSI) HSP 1 Score: 80.9 bits (198), Expect = 3.750e-17 Identity = 40/56 (71.43%), Postives = 45/56 (80.36%), Query Frame = 1 Query: 139 MTSEGNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPILVVRV 306 M +EG +R DAFAIAL+QAC GGEKRWYTST ELQL SL++CRACR P L VRV Sbjct: 1 MPTEGYTRSFDAFAIALSQACEGGEKRWYTSTTELQLGSLDICRACRSTPTLHVRV 56
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: A0A6H5KNI6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KNI6_9PHAE) HSP 1 Score: 85.1 bits (209), Expect = 3.890e-17 Identity = 41/56 (73.21%), Postives = 46/56 (82.14%), Query Frame = 1 Query: 139 MTSEGNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPILVVRV 306 MT++GNS+C DAF +ALNQAC G EKRWY STLELQL SLE+C ACRRV L VRV Sbjct: 1 MTTKGNSKCLDAFVVALNQACDGQEKRWYVSTLELQLVSLEVCGACRRVQTLHVRV 56
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: D7G0Z9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0Z9_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 1.110e-15 Identity = 42/74 (56.76%), Postives = 48/74 (64.86%), Query Frame = 1 Query: 85 LLSMYIEPEVGKTSEGSTMTSEGNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPILVVRV 306 L S E ++G+ + MT S+C DAF +ALNQ C G EKRWY STLELQL SLE C ACR VP L VRV Sbjct: 20 LASKLTEEQLGQVKQ---MTRR--SKCLDAFVVALNQTCDGQEKRWYASTLELQLVSLEFCGACRHVPTLHVRV 88
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: A0A6H5LIJ3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LIJ3_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 1.940e-14 Identity = 38/53 (71.70%), Postives = 41/53 (77.36%), Query Frame = 1 Query: 148 EGNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPILVVRV 306 E +RC DAF IAL+QAC GGEKRWY STLELQL SL+LCRACR IL V V Sbjct: 6 EWRTRCLDAFVIALSQACEGGEKRWYASTLELQLTSLDLCRACRTTSILHVHV 58
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: A0A6H5L1V9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L1V9_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 3.260e-14 Identity = 36/52 (69.23%), Postives = 40/52 (76.92%), Query Frame = 1 Query: 139 MTSEGNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPIL 294 MTSE RC DAF +AL+Q GGEKRWYTSTL+LQLASLE C ACR P+L Sbjct: 1 MTSEAQRRCLDAFVVALSQCYEGGEKRWYTSTLQLQLASLEFCGACRSTPML 52
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: A0A6H5KLV1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KLV1_9PHAE) HSP 1 Score: 75.9 bits (185), Expect = 5.470e-14 Identity = 37/52 (71.15%), Postives = 38/52 (73.08%), Query Frame = 1 Query: 151 GNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPILVVRV 306 G S C AF +ALNQ C G EKRWY STLELQL SLE C ACRRVP L VRV Sbjct: 13 GRSECLRAFIVALNQTCNGQEKRWYASTLELQLVSLEFCGACRRVPTLHVRV 64
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: A0A6H5KXX4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXX4_9PHAE) HSP 1 Score: 72.4 bits (176), Expect = 1.090e-12 Identity = 39/56 (69.64%), Postives = 43/56 (76.79%), Query Frame = 1 Query: 139 MTSEGNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPILVVRV 306 M SEG SR DA IA++QA G KRWYTSTLEL+LASLE CRACRRVP + VRV Sbjct: 1 MDSEGASRGFDALIIAISQAYEGRGKRWYTSTLELRLASLETCRACRRVPTIHVRV 56
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: A0A6H5K2L2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K2L2_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 1.600e-12 Identity = 31/46 (67.39%), Postives = 34/46 (73.91%), Query Frame = 1 Query: 151 GNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVP 288 G C DAF +ALN+ C GGE+RWY STLELQ SLE C ACRRVP Sbjct: 15 GRGECVDAFIVALNRTCDGGEQRWYASTLELQPVSLEFCVACRRVP 60
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: A0A6H5KVM8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KVM8_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 4.080e-11 Identity = 33/52 (63.46%), Postives = 39/52 (75.00%), Query Frame = 1 Query: 151 GNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPILVVRV 306 G ++C DAF +AL+QAC GG KR YTSTLEL LASL++CRA R L VRV Sbjct: 18 GPTQCFDAFVVALSQACEGGNKRSYTSTLELPLASLDICRAGRSTSTLHVRV 69
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Match: D7FTK8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTK8_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 1.220e-10 Identity = 31/49 (63.27%), Postives = 33/49 (67.35%), Query Frame = 1 Query: 148 EGNSRCADAFAIALNQACGGGEKRWYTSTLELQLASLELCRACRRVPIL 294 EG D +ALNQAC G EKRWY STLELQL SLELC ACR +L Sbjct: 84 EGGGSSLDTLIVALNQACDGQEKRWYVSTLELQLVSLELCGACRSAQLL 132 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8364.17364.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig8364.17364.1 >prot_L-elsbetiae_contig8364.17364.1 ID=prot_L-elsbetiae_contig8364.17364.1|Name=mRNA_L-elsbetiae_contig8364.17364.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=102bp EEARKAEVLPCAACSKERLEGSRTLVTGLLSMYIEPEVGKTSEGSTMTSEback to top mRNA from alignment at L-elsbetiae_contig8364:4941..8556- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig8364.17364.1 ID=mRNA_L-elsbetiae_contig8364.17364.1|Name=mRNA_L-elsbetiae_contig8364.17364.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=3616bp|location=Sequence derived from alignment at L-elsbetiae_contig8364:4941..8556- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig8364:4941..8556- >mRNA_L-elsbetiae_contig8364.17364.1 ID=mRNA_L-elsbetiae_contig8364.17364.1|Name=mRNA_L-elsbetiae_contig8364.17364.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=612bp|location=Sequence derived from alignment at L-elsbetiae_contig8364:4941..8556- (Laminarionema elsbetiae ELsaHSoW15)back to top |