mRNA_L-elsbetiae_contig833.17336.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig833.17336.1 vs. uniprot
Match: A0A6H5KP54_9PHAE (CULT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KP54_9PHAE) HSP 1 Score: 106 bits (264), Expect = 2.180e-23 Identity = 54/70 (77.14%), Postives = 60/70 (85.71%), Query Frame = 2 Query: 338 PLPTAATHSYLGEAT--GSSLSRRDLEVGSTIDMPILSLPGVVLFPGESLPLRLHNPAYALLAESLLGSG 541 PLPT ATH+YLGEAT SSLSR+DLE GST+++PIL+LPGVVLFPGESLPLRLHNPAYA L S LG G Sbjct: 108 PLPTPATHAYLGEATTGSSSLSRKDLEEGSTVEIPILALPGVVLFPGESLPLRLHNPAYADLVGSFLGGG 177
BLAST of mRNA_L-elsbetiae_contig833.17336.1 vs. uniprot
Match: D8LLP2_ECTSI (Protein cereblon n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLP2_ECTSI) HSP 1 Score: 101 bits (251), Expect = 1.200e-21 Identity = 51/65 (78.46%), Postives = 57/65 (87.69%), Query Frame = 2 Query: 353 ATHSYLGEAT--GSSLSRRDLEVGSTIDMPILSLPGVVLFPGESLPLRLHNPAYALLAESLLGSG 541 ATH+YLGEAT SSLSR+DLE GST+++PIL+LPGVVLFPGESLPLRLHNPAYA L ES LG G Sbjct: 54 ATHAYLGEATTGSSSLSRKDLEEGSTVEIPILALPGVVLFPGESLPLRLHNPAYADLVESFLGGG 118
BLAST of mRNA_L-elsbetiae_contig833.17336.1 vs. uniprot
Match: D8TQU6_VOLCA (CULT domain-containing protein n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8TQU6_VOLCA) HSP 1 Score: 54.7 bits (130), Expect = 1.690e-5 Identity = 30/62 (48.39%), Postives = 36/62 (58.06%), Query Frame = 2 Query: 347 TAATHSYLGEATGSSLSRRDLEVGSTIDMPILSLPGVVLFPGESLPLRLHNPAYALLAESLL 532 TAA H YLG+ R LE G+T +P+ L GVVL PGE+LPL LH+P L E L Sbjct: 102 TAAQHRYLGDVDELGGGSRLLEEGATYTLPLFPLEGVVLLPGENLPLFLHSPQDVLKLERAL 163 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig833.17336.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig833.17336.1 >prot_L-elsbetiae_contig833.17336.1 ID=prot_L-elsbetiae_contig833.17336.1|Name=mRNA_L-elsbetiae_contig833.17336.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=112bp MDGWEEGANPPPPQANAQNSGSGSSGSSSGIFSVTSSTAAPALMPLPTAAback to top mRNA from alignment at L-elsbetiae_contig833:25423..25963+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig833.17336.1 ID=mRNA_L-elsbetiae_contig833.17336.1|Name=mRNA_L-elsbetiae_contig833.17336.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=541bp|location=Sequence derived from alignment at L-elsbetiae_contig833:25423..25963+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig833:25423..25963+ >mRNA_L-elsbetiae_contig833.17336.1 ID=mRNA_L-elsbetiae_contig833.17336.1|Name=mRNA_L-elsbetiae_contig833.17336.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=672bp|location=Sequence derived from alignment at L-elsbetiae_contig833:25423..25963+ (Laminarionema elsbetiae ELsaHSoW15)back to top |