mRNA_L-elsbetiae_contig8323.17326.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8323.17326.1 vs. uniprot
Match: A0A6H5J7P3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J7P3_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 2.620e-9 Identity = 29/41 (70.73%), Postives = 32/41 (78.05%), Query Frame = 3 Query: 12 IGAKGVGNQADRGKCMERAISMFAGKGMEGVPRDVVLALMR 134 IGA G GNQ RG C RA+ MF GKGMEG+PRDVVLAL+R Sbjct: 182 IGASGQGNQCRRGDCFARAMGMFFGKGMEGIPRDVVLALLR 222 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8323.17326.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig8323.17326.1 >prot_L-elsbetiae_contig8323.17326.1 ID=prot_L-elsbetiae_contig8323.17326.1|Name=mRNA_L-elsbetiae_contig8323.17326.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=44bp MIGAKGVGNQADRGKCMERAISMFAGKGMEGVPRDVVLALMRG*back to top mRNA from alignment at L-elsbetiae_contig8323:1760..2063+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig8323.17326.1 ID=mRNA_L-elsbetiae_contig8323.17326.1|Name=mRNA_L-elsbetiae_contig8323.17326.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=304bp|location=Sequence derived from alignment at L-elsbetiae_contig8323:1760..2063+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig8323:1760..2063+ >mRNA_L-elsbetiae_contig8323.17326.1 ID=mRNA_L-elsbetiae_contig8323.17326.1|Name=mRNA_L-elsbetiae_contig8323.17326.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=264bp|location=Sequence derived from alignment at L-elsbetiae_contig8323:1760..2063+ (Laminarionema elsbetiae ELsaHSoW15)back to top |