mRNA_L-elsbetiae_contig8283.17292.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8283.17292.1 vs. uniprot
Match: A0A6H5K5N3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5N3_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 3.500e-7 Identity = 23/39 (58.97%), Postives = 30/39 (76.92%), Query Frame = -1 Query: 583 KTAEFCFEHKRDGMVDVLSRRCAHQGCTKQPVFGIVGTK 699 K AEFC +HK+ MV+V+S+RC H GCTKQP +G G+K Sbjct: 20 KNAEFCSQHKQQDMVNVVSKRCGHPGCTKQPSYGRAGSK 58
BLAST of mRNA_L-elsbetiae_contig8283.17292.1 vs. uniprot
Match: D7FR73_ECTSI (EsV-1-7 (Partial) (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FR73_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 4.980e-5 Identity = 23/40 (57.50%), Postives = 30/40 (75.00%), Query Frame = -1 Query: 583 KTAEFCFEHKRDGMVDVLSRRCAHQGCT-KQPVFGIVGTK 699 KTA FC H R+GM DV+S+RCA QGCT + P FG+ G++ Sbjct: 32 KTAPFCMSHAREGMEDVVSKRCAFQGCTVRNPRFGVPGSR 71 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8283.17292.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig8283.17292.1 >prot_L-elsbetiae_contig8283.17292.1 ID=prot_L-elsbetiae_contig8283.17292.1|Name=mRNA_L-elsbetiae_contig8283.17292.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=147bp MARLVGASGAVATLVLDIHHPVFLMFRAELPCFRADNTKDRMLGAPLVDAback to top mRNA from alignment at L-elsbetiae_contig8283:6674..7372+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig8283.17292.1 ID=mRNA_L-elsbetiae_contig8283.17292.1|Name=mRNA_L-elsbetiae_contig8283.17292.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=699bp|location=Sequence derived from alignment at L-elsbetiae_contig8283:6674..7372+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig8283:6674..7372+ >mRNA_L-elsbetiae_contig8283.17292.1 ID=mRNA_L-elsbetiae_contig8283.17292.1|Name=mRNA_L-elsbetiae_contig8283.17292.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=882bp|location=Sequence derived from alignment at L-elsbetiae_contig8283:6674..7372+ (Laminarionema elsbetiae ELsaHSoW15)back to top |