mRNA_L-elsbetiae_contig8274.17277.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig8274.17277.1 vs. uniprot
Match: A0A6H5J8B2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8B2_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 3.740e-7 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = -2 Query: 453 IPGYGATIKRPMDLQSMYYKVQYGAFGGLRLDAVADSAPAVV 578 +P YGA IKRPMDLQSMYYKVQ+G+FGGL AV ++ P +V Sbjct: 272 LPLYGALIKRPMDLQSMYYKVQFGSFGGLHPSAVPNTDPPLV 313 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig8274.17277.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig8274.17277.1 >prot_L-elsbetiae_contig8274.17277.1 ID=prot_L-elsbetiae_contig8274.17277.1|Name=mRNA_L-elsbetiae_contig8274.17277.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=159bp MSPGSPASLPAPAEGYNSWGSPFAPPISCGALSPLLPPCALNAAAAAAAAback to top mRNA from alignment at L-elsbetiae_contig8274:7017..7595+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig8274.17277.1 ID=mRNA_L-elsbetiae_contig8274.17277.1|Name=mRNA_L-elsbetiae_contig8274.17277.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=579bp|location=Sequence derived from alignment at L-elsbetiae_contig8274:7017..7595+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig8274:7017..7595+ >mRNA_L-elsbetiae_contig8274.17277.1 ID=mRNA_L-elsbetiae_contig8274.17277.1|Name=mRNA_L-elsbetiae_contig8274.17277.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=954bp|location=Sequence derived from alignment at L-elsbetiae_contig8274:7017..7595+ (Laminarionema elsbetiae ELsaHSoW15)back to top |