mRNA_L-elsbetiae_contig7929.16891.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7929.16891.1 vs. uniprot
Match: D8LM54_ECTSI (Glutathione S-transferase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM54_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 2.120e-12 Identity = 29/35 (82.86%), Postives = 31/35 (88.57%), Query Frame = -3 Query: 10 DMDGAAEPTRWALEQGGLEWTDKRVTREEFGDLKP 114 DM GAAEP RWALE+GGLEW DKR+TREEFG LKP Sbjct: 11 DMAGAAEPVRWALEKGGLEWEDKRLTREEFGALKP 45
BLAST of mRNA_L-elsbetiae_contig7929.16891.1 vs. uniprot
Match: A0A6H5KRV2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRV2_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 8.770e-10 Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = -3 Query: 7 DMDGAAEPTRWALEQGGLEWTDKRVTREEFGDLKPS 114 D GAAEP RWALE+G LEW DKR+TREEFG LKPS Sbjct: 11 DKAGAAEPIRWALEKGSLEWEDKRLTREEFGALKPS 46
BLAST of mRNA_L-elsbetiae_contig7929.16891.1 vs. uniprot
Match: B1N8E8_9PHAE (Glutathione S-transferase 3 n=1 Tax=Laminaria digitata TaxID=80365 RepID=B1N8E8_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 2.490e-8 Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = -3 Query: 7 DMDGAAEPTRWALEQGGLEWTDKRVTREEFGDLKPS 114 D+ GAAEP RWALEQ G EW DKR+T EEFG +KPS Sbjct: 11 DIPGAAEPIRWALEQSGQEWEDKRLTGEEFGVVKPS 46 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7929.16891.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7929.16891.1 >prot_L-elsbetiae_contig7929.16891.1 ID=prot_L-elsbetiae_contig7929.16891.1|Name=mRNA_L-elsbetiae_contig7929.16891.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=109bp QLTWLEIPKFFPGHALVGPLKPSLLQGPAGRFRGTVHVTAAGARIKQRGAback to top mRNA from alignment at L-elsbetiae_contig7929:2179..2522+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7929.16891.1 ID=mRNA_L-elsbetiae_contig7929.16891.1|Name=mRNA_L-elsbetiae_contig7929.16891.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=344bp|location=Sequence derived from alignment at L-elsbetiae_contig7929:2179..2522+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7929:2179..2522+ >mRNA_L-elsbetiae_contig7929.16891.1 ID=mRNA_L-elsbetiae_contig7929.16891.1|Name=mRNA_L-elsbetiae_contig7929.16891.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=654bp|location=Sequence derived from alignment at L-elsbetiae_contig7929:2179..2522+ (Laminarionema elsbetiae ELsaHSoW15)back to top |